PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000464.1_g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 312aa    MW: 35616.3 Da    PI: 10.2573
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000464.1_g00023.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12.1e-182570147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  Itr_sc000464.1_g00023.1 25 RGHWRPAEDEKLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 70
                             899*****************************.***********996 PP

2Myb_DNA-binding59.95.6e-1977121147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r ++++eE+e+lv a++ +G++ W++I+r ++ gRt++ +k++w+ +
  Itr_sc000464.1_g00023.1  77 RRPFSEEEEERLVAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHVL 121
                              679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.5392071IPR017930Myb domain
SMARTSM007173.9E-152473IPR001005SANT/Myb domain
SuperFamilySSF466893.74E-2924118IPR009057Homeodomain-like
PfamPF002491.4E-172570IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-272678IPR009057Homeodomain-like
CDDcd001671.33E-132869No hitNo description
PROSITE profilePS5129427.47472126IPR017930Myb domain
SMARTSM007175.9E-1676124IPR001005SANT/Myb domain
PfamPF002491.9E-1577121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2079124IPR009057Homeodomain-like
CDDcd001671.24E-1179122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVETTGGGGA AASASSDDSS RTCPRGHWRP AEDEKLRQLV EQYGPQNWNS IAEKLQGRSG  60
KSCRLRWFNQ LDPRINRRPF SEEEEERLVA AHRIHGNKWA LISRLFPGRT DNAVKNHWHV  120
LMARRQREQS KLSVKRTYQQ VFNNVNDTNV FRRRYKSPDP DPYPYPSNKI ISFLEFQNNP  180
ADSRPNTFSL SKYTPQAPPL RPTASSSDYS LLRHHKNLGF SLVGSHGNGG IRSDPHNLIK  240
TGNSFLNYSS TFNDGGRGSG AKNHERDYLF TEKRERNDPQ QELRQDKEDG GEDKRERRAV  300
TFIDFLGVGS SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30251257107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597907.13e-90PREDICTED: myb-related protein B-like
RefseqXP_016438115.13e-90PREDICTED: myb-related protein B-like
TrEMBLK4BT451e-81K4BT45_SOLLC; Uncharacterized protein
STRINGSolyc04g064540.2.14e-81(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-67myb domain protein 52